PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG017409.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 406aa    MW: 44937.4 Da    PI: 7.5964
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG017409.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1049.3e-33261316156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+peLH+rFv+a++qLGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  CCG017409.1 261 KQRRCWSPELHRRFVNALQQLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 316
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.82E-18258319IPR009057Homeodomain-like
PROSITE profilePS5129414.115258318IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-29259319IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-27261316IPR006447Myb domain, plants
PfamPF002496.4E-8263314IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MGSLSPELSL DFVRPSTAKT LPFLPKTIAD FLREVSVIGD PAVKVLKVDG FIKDLEEEKR  60
KIDAFKRELP LCMLLLNDAI QVLREELMQR GASKNQQPVL EEFIPLKKNI DDHHENDVLI  120
EEKDSKDKKN WMSSVQLWNA DDHHPSTDYL FDPKQNLKLE SKTNKKGNQY GNEDAFQACI  180
GRTAARTFMP FTACTGLSSK EEKLPVPSLS LSTPGIKSLK EESNSTGSRS SCSRSVSTIS  240
GPNSESNLRN GPQSQQQTAR KQRRCWSPEL HRRFVNALQQ LGGSQAATPK QIRELMQVDG  300
LTNDEVKSHL QKYRLHTRRV TPATAAAPAN QSVVVLGGLW MTQDQYGDSS KATSSQSGSP  360
QGPLQLAVNT GGTSTTGGDS MEDDEDAKSE GYSWKSHIHR SGKEDV
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1472190.0EF147219.1 Populus trichocarpa clone WS01229_I10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010999925.10.0PREDICTED: uncharacterized protein LOC105107622
TrEMBLB9HRW40.0B9HRW4_POPTR; Uncharacterized protein
STRINGPOPTR_0009s10980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.17e-59G2-like family protein